General Information

  • ID:  hor000961
  • Uniprot ID:  P80344
  • Protein name:  Cholecystokinin-33
  • Gene name:  CCK
  • Organism:  Lithobates catesbeianus (American bullfrog) (Rana catesbeiana)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Expressed in brain, lung, testis and throughout the length of the small intestine. In the brain, expressed predominantly in the optic tectum and brain stem.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lithobates (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
  • Length:  33(86-118)
  • Propeptide:  MYIGICICVLLAALSASSTGQQTVGSMNEDPGAREIEQQNILQHPRHIRASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
  • Signal peptide:  MYIGICICVLLAALSASSTG
  • Modification:  T27 Sulfotyrosine;T33 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.
  • Mechanism:  Frog brain contains CCK-octapeptide (CCK8) and CCK7; whereas the gut contains intact CCK33 and CCK58.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80344-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000961_AF2.pdbhor000961_ESM.pdb

Physical Information

Mass: 440924 Formula: C168H254N50O50S2
Absent amino acids: CEKQ Common amino acids: DR
pI: 7.54 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -76.06 Boman Index: -8724
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 56.06
Instability Index: 5502.12 Extinction Coefficient cystines: 8480
Absorbance 280nm: 265

Literature

  • PubMed ID:  7925386
  • Title:  Identification of Cholecystokinin From Frog and Turtle. Divergence of Cholecystokinin and Gastrin Occurred Before the Evolution of Amphibia